BNP Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesNPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
ProductOrderB
FormulationThe protein was lyophilized without additives.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH.
Catalog#: Pr20219
Inquire
Contact us to order
Images
BNP Human Recombinant Protein
BNP Human Recombinant Protein
Product Overview
Description

B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.