Sign up for news & promotions:
HBsAg preS2 Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | ||
Pr20941 |
Specification | |
---|---|
Product Order | H |
Formulation | HBsAg protein was lyophilized from 0.2μM filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Virus |
Sequence |
---|
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN. |
Images

Product Overview
Description | The E.coli derivedRecombinant Hepatitis B Surface Antigen preS2 is a single non-glycosylated polypeptide chain containing 55 amino acids & having a molecular weight of5.7 kDa. |
---|