HBsAg preS2 Recombinant Protein

Item Information
Catalog #
Pr20941
Specification
Product OrderH
FormulationHBsAg protein was lyophilized from 0.2μM filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityVirus
Sequence
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN.
Catalog
Pr20941
$50.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description The E.coli derivedRecombinant Hepatitis B Surface Antigen preS2 is a single non-glycosylated polypeptide chain containing 55 amino acids & having a molecular weight of5.7 kDa.

Please view FAQs here