Sign up for news & promotions:
HBsAg preS2 Recombinant Protein
| Item Information | ||
|---|---|---|
| Catalog # | ||
| Pr20941 | ||
| Specification | |
|---|---|
| Product Order | H |
| Formulation | HBsAg protein was lyophilized from 0.2μM filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl. |
| Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
| Species Reactivity | Virus |
| Sequence |
|---|
| MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN. |
Images
Product Overview
| Description | The E.coli derivedRecombinant Hepatitis B Surface Antigen preS2 is a single non-glycosylated polypeptide chain containing 55 amino acids & having a molecular weight of5.7 kDa. |
|---|