Sign up for news & promotions:
HBsAg preS1 Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | ||
Pr20940 |
Specification | |
---|---|
Product Order | H |
Formulation | HBsAg protein was lyophilized from 0.2μM filtered (1mg/ml) solution in 20mM PB, pH 7.4, and 50mM NaCl. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Virus |
Sequence |
---|
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA. |
Images

Product Overview
Description | The E.Coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa. |
---|