Sign up for news & promotions:
CNTF Rat Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | ||
Pr20384 |
Specification | |
---|---|
Aliases | HCNTF, CNTF, Ciliary Neurotrophic Factor. |
Product Order | C |
Formulation | Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Rat |
Sequence |
---|
AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM. |
Images

Product Overview
Description | CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary technologyary technonlogyary chromatographic techniques. |
---|