Sign up for news & promotions:
CNTF Rat Recombinant Protein
| Item Information | ||
|---|---|---|
| Catalog # | ||
| Pr20384 | ||
| Specification | |
|---|---|
| Aliases | HCNTF, CNTF, Ciliary Neurotrophic Factor. |
| Product Order | C |
| Formulation | Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3. |
| Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
| Species Reactivity | Rat |
| Sequence |
|---|
| AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM. |
Images
Product Overview
| Description | CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary technologyary technonlogyary chromatographic techniques. |
|---|