CNTF Rat Recombinant Protein

Item Information
Catalog #
Specification
AliasesHCNTF, CNTF, Ciliary Neurotrophic Factor.
Product OrderC
FormulationLyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityRat
Sequence
AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM.
Catalog
Pr20384
$50.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary technologyary technonlogyary chromatographic techniques.

Please view FAQs here