HMGB1 Human Recombinant Protein

Item Information
Catalog #
Pr21108
Specification
AliasesHMG1, HMG3, SBP-1, Amphoterin, HMGB1, High-Mobility Group Box 1.
Product OrderH
FormulationThe HMG1 (1 mg/ml) was lyophilized after extensive dialyses against 1x PBS pH-7.4.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityHuman
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH.
Catalog
Pr21108
$50.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description HMG1 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids and having a molecular mass of 26 kDa.The HMGB-1 is purified by proprietary technologyary technonlogyary chromatographic techniques.

Please view FAQs here