Sign up for news & promotions:
GNLY Human Recombinant Protein
| Item Information | ||
|---|---|---|
| Catalog # | ||
| Pr20830 | ||
| Specification | |
|---|---|
| Aliases | LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E. |
| Product Order | G |
| Formulation | The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives. |
| Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
| Species Reactivity | Human |
| Sequence |
|---|
| MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH |
Images
Product Overview
| Description | GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa.The GNLY is purified by proprietary technologyary technonlogyary chr |
|---|