ESAT6 Recombinant Protein

Item Information
Catalog #
Specification
AliasesEarly Secretory Target Mycobacterium Tuberculosis, ESAT-6.
Product OrderE
FormulationThe protein (1mg/ml) was lyophilized after from a sterile solution containing 50mM Tris-HCl, pH 8.0, 1mM EDTA and 1mM DTT.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityBacteria
Sequence
AEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSG\ \ SEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMF\ \ AKLAAALEHHHHHH.
Catalog
Pr20615
$50.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description ESAT-6 Recombinant produced in e.coli is a single, non-glycosylated, polypeptide having a total molecular mass of 11261.35 Dalton.The ESAT-6 contains 6 additional amino acid residues - His-Tag.

Please view FAQs here