Sign up for news & promotions:
ESAT6 Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | ||
Pr20615 |
Specification | |
---|---|
Aliases | Early Secretory Target Mycobacterium Tuberculosis, ESAT-6. |
Product Order | E |
Formulation | The protein (1mg/ml) was lyophilized after from a sterile solution containing 50mM Tris-HCl, pH 8.0, 1mM EDTA and 1mM DTT. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Bacteria |
Sequence |
---|
AEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSG\ \ SEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMF\ \ AKLAAALEHHHHHH. |
Images

Product Overview
Description | ESAT-6 Recombinant produced in e.coli is a single, non-glycosylated, polypeptide having a total molecular mass of 11261.35 Dalton.The ESAT-6 contains 6 additional amino acid residues - His-Tag. |
---|