BNP Human Recombinant Protein

Item Information
Catalog #
Specification
AliasesNPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
Product OrderB
FormulationThe protein was lyophilized without additives.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityHuman
Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH.
Catalog
Pr20219
$300.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.

Please view FAQs here