Sign up for news & promotions:
BNP Human Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | ||
Pr20219 |
Specification | |
---|---|
Aliases | NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide. |
Product Order | B |
Formulation | The protein was lyophilized without additives. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Human |
Sequence |
---|
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH. |
Images

Product Overview
Description | B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. |
---|