Sign up for news & promotions:
BNP Human Recombinant Protein
| Item Information | ||
|---|---|---|
| Catalog # | ||
| Pr20219 | ||
| Specification | |
|---|---|
| Aliases | NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide. |
| Product Order | B |
| Formulation | The protein was lyophilized without additives. |
| Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
| Species Reactivity | Human |
| Sequence |
|---|
| SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH. |
Images
Product Overview
| Description | B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. |
|---|