BNP Human Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | Size/Concentration | Price |
Specification | |
---|---|
Aliases | NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide. |
ProductOrder | B |
Formulation | The protein was lyophilized without additives. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Human |
Sequence | |
---|---|
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH. |