Sign up for news & promotions:
BMP 7 Human Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | ||
Pr20216 |
Specification | |
---|---|
Aliases | Osteogenic Protein 1, BMP-7. |
Product Order | B |
Formulation | BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Human |
Sequence |
---|
HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH. |
Images

Product Overview
Description | Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by |
---|