BMP 7 Human Recombinant Protein

Item Information
Catalog #
Specification
AliasesOsteogenic Protein 1, BMP-7.
Product OrderB
FormulationBMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityHuman
Sequence
HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.
Catalog
Pr20216
$50.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by

Please view FAQs here