BMP 7 Human Recombinant Protein

Item Information
Catalog #

Specification
Aliases	Osteogenic Protein 1, BMP-7.
Product Order	B
Formulation	BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Shipping Information	This product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species Reactivity	Human

Sequence
HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.

Images

Product Overview

Description	Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by