Acrp30 Human Recombinant Protein

Item Information
Catalog #

Specification
Aliases	Acrp30, AdipoQ, GBP-28, APM-1, ACDC.
Product Order	A
Formulation	Acrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1 mM DTT.
Shipping Information	This product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species Reactivity	Human

Sequence
MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Images

Product Overview

Description	The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244).