Sign up for news & promotions:
Acrp30 Human Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | ||
Pr20017 |
Specification | |
---|---|
Aliases | Acrp30, AdipoQ, GBP-28, APM-1, ACDC. |
Product Order | A |
Formulation | Acrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1 mM DTT. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Human |
Sequence |
---|
MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
Images

Product Overview
Description | The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244). |
---|