Acrp30 Human Recombinant Protein

Item Information
Catalog #
Specification
AliasesAcrp30, AdipoQ, GBP-28, APM-1, ACDC.
Product OrderA
FormulationAcrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1 mM DTT.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityHuman
Sequence
MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Catalog
Pr20017
$50.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244).

Please view FAQs here