Sign up for news & promotions:
Acrp30 Human Recombinant Protein
| Item Information | ||
|---|---|---|
| Catalog # | ||
| Pr20017 | ||
| Specification | |
|---|---|
| Aliases | Acrp30, AdipoQ, GBP-28, APM-1, ACDC. |
| Product Order | A |
| Formulation | Acrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1 mM DTT. |
| Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
| Species Reactivity | Human |
| Sequence |
|---|
| MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
Images
Product Overview
| Description | The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244). |
|---|