Sign up for news & promotions:
HCC 1 Human Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | ||
Pr20948 |
Specification | |
---|---|
Aliases | Small inducible cytokine A14, CCL14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, chemokine (C-C motif) ligand 14, CC-1, CC-3, CKb1, MCIF, SY14, HCC-1, HCC-3, SCYL2, SCYA14. |
Product Order | H |
Formulation | The CCL14 protein was lyophilized with 20mM PBS pH-7.4 and 150mM NaCl. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Human |
Sequence |
---|
TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN. |
Images

Product Overview
Description | HCC-1 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 72 amino acids and having a molecular mass of 8411 Dalton. The HCC-1 is purified by proprietary technologyary technonlogyary chromatographic techniques. |
---|