Eotaxin 2 Human Recombinant Protein

Item Information
Catalog #
Specification
AliasesC-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24.
Product OrderE
FormulationThe CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityHuman
Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA.
Catalog
Pr20594
$50.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description CCL24 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purified by proprietary technologyary technonlogyary chromatographic techniques.

Please view FAQs here