HBsAg preS1 Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | Size/Concentration | Price |
Specification | |
---|---|
ProductOrder | H |
Formulation | HBsAg protein was lyophilized from 0.2μM filtered (1mg/ml) solution in 20mM PB, pH 7.4, and 50mM NaCl. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Virus |
Sequence | |
---|---|
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA. |