SUMO2 Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesSmall ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191.
ProductOrderS
FormulationSUMO2 at 100μg/ml in 50mM Tris-Acetate, pH7.5, 1mM EDTA and 20% Glycerol.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG.
Catalog#: Pr22238
Inquire
Contact us to order
Images
SUMO2 Human Recombinant Protein
SUMO2 Human Recombinant Protein
Product Overview
Description

SUMO2 Human Recombinant full length protein expressed in E.coli, shows a 36 kDa band on SDS-PAGE(including GST tag).The SUMO2 is purified by proprietary technologyary technonlogyary chromatographic techniques.