SUMO2 Human Recombinant Protein
| Item Information | ||
|---|---|---|
| Catalog # | Size/Concentration | Price |
| Specification | |
|---|---|
| Aliases | Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191. |
| ProductOrder | S |
| Formulation | SUMO2 at 100μg/ml in 50mM Tris-Acetate, pH7.5, 1mM EDTA and 20% Glycerol. |
| Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
| Species Reactivity | Human |
| Sequence | |
|---|---|
| MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG. | |
SUMO2 Human Recombinant Protein
