SPARC Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesOsteonectin, ON, Basement-membrane protein 40, BM-40, SPARC, Secreted Protein acidic and Rich in Cysteine.
ProductOrderS
FormulationThe SPARC (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
MSYYHHHHHHPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ
Catalog#: Pr22197
Inquire
Contact us to order
Images
SPARC Human Recombinant Protein
SPARC Human Recombinant Protein
Product Overview
Description

Osteonectin Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 295 amino acids and having a molecular mass of 34 kDa.The BM40 is purified by proprietary technologyary technonlogyary chromatographic techniques.