SDC4 Human Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | Size/Concentration | Price |
Specification | |
---|---|
Aliases | SDC4, SYND4, SYND-4, Amphiglycan, Ryudocan core protein, Syndecan-4. |
ProductOrder | S |
Formulation | The SDC4 (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Human |
Sequence | |
---|---|
MASIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLALEHHHHHH. |