SDC4 Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesSDC4, SYND4, SYND-4, Amphiglycan, Ryudocan core protein, Syndecan-4.
ProductOrderS
FormulationThe SDC4 (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
MASIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLALEHHHHHH.
Catalog#: Pr22103
Inquire
Contact us to order
Images
SDC4 Human Recombinant Protein
SDC4 Human Recombinant Protein
Product Overview
Description

Syndecan-4 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 140 amino acids and having a molecular mass of 15.4 kDa. The SDC4 is purified by proprietary technologyary technonlogyary chromatographic techniques.