SPP1 Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesSecreted Phosphoprotein-1, OPN, BNSP, BSPI, ETA-1, MGC110940, SPP-1, Osteopontin, Bone sialoprotein 1, Urinary stone protein, Nephropontin, Uropontin, SPP1.
ProductOrderS
FormulationOsteopontin is supplied in 50mM Tris, 300mM NaCl and 10% Glycerol, pH 7.5.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVD
Catalog#: Pr22201
Inquire
Contact us to order
Images
SPP1 Human Recombinant Protein
SPP1 Human Recombinant Protein
Product Overview
Description

Osteopontin Human Recombinant is a single, glycosylated, polypeptide chain produced in HEK293 cells, is a full length protein (amino acids 17-314) fused with a polyhistidine tag at the C-terminus, having a total calculated molecular mass of 34.5kDa (Th