SPP1 Human Recombinant Protein
| Item Information | ||
|---|---|---|
| Catalog # | Size/Concentration | Price |
| Specification | |
|---|---|
| Aliases | Secreted Phosphoprotein-1, OPN, BNSP, BSPI, ETA-1, MGC110940, SPP-1, Osteopontin, Bone sialoprotein 1, Urinary stone protein, Nephropontin, Uropontin, SPP1. |
| ProductOrder | S |
| Formulation | Osteopontin is supplied in 50mM Tris, 300mM NaCl and 10% Glycerol, pH 7.5. |
| Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
| Species Reactivity | Human |
| Sequence | |
|---|---|
| IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVD | |
SPP1 Human Recombinant Protein
