ESAT6 Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | Size/Concentration | Price |
Specification | |
---|---|
Aliases | Early Secretory Target Mycobacterium Tuberculosis, ESAT-6. |
ProductOrder | E |
Formulation | The protein (1mg/ml) was lyophilized after from a sterile solution containing 50mM Tris-HCl, pH 8.0, 1mM EDTA and 1mM DTT. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Bacteria |
Sequence | |
---|---|
AEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSG SEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMF AKLAAALEHHHHHH. |