TFF1 Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesTFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein.
ProductOrderT
FormulationThe protein was lyophilized after dialysis against 1xPBS pH-7.4.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF.
Catalog#: Pr22290
Inquire
Contact us to order
Images
TFF1 Human Recombinant Protein
TFF1 Human Recombinant Protein
Product Overview
Description

TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved interamolecular disulfide bonds and having a total molecular m