IFN b Mouse Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesLeukocyte interferon, B cell interferon, Type I interferon, IFNB1, IFB, IFF, IFNB, IFN-b 1b, MGC96956.
ProductOrderI
FormulationIFN-b Mouse solution containing 10mM sodium phosphate pH-7.5 and 0.5M ammonium sulfate.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityMouse
Sequence
MINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN.
Catalog#: Pr21191
Inquire
Contact us to order
Images
IFN b Mouse Recombinant Protein
IFN b Mouse Recombinant Protein
Product Overview
Description

Interferon beta Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 162 amino acids and having a molecular mass of 19.8 kDa.Mouse IFN beta is purified by proprietary technologyary technonlogyary chromatographic techniques.