Endoglin Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesCD105, ENG, END, ORW, HHT1, ORW1, FLJ41744, Endoglin.
ProductOrderE
FormulationEndoglin was lyophilized from a concentrated (1mg/ml) sterile solution containing 1xPBS.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTY TTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVL SVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPI TSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLE GVAGHKEAHILRVLPGHSAGPRTVTVKVE
Catalog#: Pr20581
Inquire
Contact us to order
Images
Endoglin Human Recombinant Protein
Endoglin Human Recombinant Protein
Product Overview
Description

CD105 Human Recombinant extracellular domain produced in baculovirus is a homodimeric, glycosylated, Polypeptide containing 586 amino acids and having a molecular mass of 61 kDa but as a result of glycosylation, migrates at 90 kDa under reducing condition