BNP Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesNPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
ProductOrderB
FormulationNatriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Catalog#: Pr20220
Inquire
Contact us to order
Images
BNP Human Recombinant Protein
BNP Human Recombinant Protein
Product Overview
Description

B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary technologyary technonlogyary chromatographic techniques.