BAFF R Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesTNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.
ProductOrderB
FormulationLyophilized from a 0.2μM filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.
Catalog#: Pr20162
Inquire
Contact us to order
Images
BAFF R Human Recombinant Protein
BAFF R Human Recombinant Protein
Product Overview
Description

B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.The BAFF-R is purified by proprietary technologyary technonlogyary chromatographi