HCC 1 Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesSmall inducible cytokine A14, CCL14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, chemokine (C-C motif) ligand 14, CC-1, CC-3, CKb1, MCIF, SY14, HCC-1, HCC-3, SCYL2, SCYA14.
ProductOrderH
FormulationThe CCL14 protein was lyophilized with 20mM PBS pH-7.4 and 150mM NaCl.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN.
Catalog#: Pr20948
Inquire
Contact us to order
Images
HCC 1 Human Recombinant Protein
HCC 1 Human Recombinant Protein
Product Overview
Description

HCC-1 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 72 amino acids and having a molecular mass of 8411 Dalton. The HCC-1 is purified by proprietary technologyary technonlogyary chromatographic techniques.