Fractalkine Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesFractalkine, CX3CL1, Neurotactin, CX3C membrane-anchored chemokine, Small inducible cytokine D1, NTN, NTT, CXC3, CXC3C, SCYD1, ABCD-3, C3Xkine.
ProductOrderF
FormulationThe CX3CL1 was lyophilized from a 0.2μM filtered concentrated (1.0 mg/ml) solution in 20mM Phosphate buffer, pH 7.4, 50mM NaCl.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQAAALTRNG.
Catalog#: Pr20713
Inquire
Contact us to order
Images
Fractalkine Human Recombinant Protein
Fractalkine Human Recombinant Protein
Product Overview
Description

Fractalkine Human Recombinant- produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8638 Dalton. The Fractalkine is purified by proprietary technologyary technonlogyary chromatographic techniques.