Fractalkine Human Recombinant Protein
| Item Information | ||
|---|---|---|
| Catalog # | Size/Concentration | Price |
| Specification | |
|---|---|
| Aliases | Fractalkine, CX3CL1, Neurotactin, CX3C membrane-anchored chemokine, Small inducible cytokine D1, NTN, NTT, CXC3, CXC3C, SCYD1, ABCD-3, C3Xkine. |
| ProductOrder | F |
| Formulation | The CX3CL1 was lyophilized from a 0.2μM filtered concentrated (1.0 mg/ml) solution in 20mM Phosphate buffer, pH 7.4, 50mM NaCl. |
| Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
| Species Reactivity | Human |
| Sequence | |
|---|---|
| QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQAAALTRNG. | |
Fractalkine Human Recombinant Protein
