IL 1 beta Rat Recombinant Protein

Item Information
Catalog #
Pr21224
Specification
AliasesCatabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Product OrderI
FormulationThe protein was lyophilized without any additives.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityRat
Sequence
VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS.
Catalog
Pr21224
$50.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 152 amino acids and having a molecular mass of 17.3 kDa. The IL-1b is purified by proprietary technologyary technonlogyary chromatographic techniques.

Please view FAQs here