Endoglin Mouse Recombinant Protein

Item Information
Catalog #
Specification
AliasesCD105, ENG, END, ORW, HHT1, ORW1, FLJ41744, Cell surface MJ7/18 antigen, Endoglin.
Product OrderE
FormulationEndoglin was lyophilized from a concentrated (1mg/ml) sterile solution containing no additives.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityMouse
Sequence
MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVT\ \ FTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVF\ \ LVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWA\ \ ATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTP\ \ VQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVM
Catalog
Pr20582
$50.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description CD105 Mouse Recombinant extracellular domain produced in baculovirus is a homodimeric, glycosylated, Polypeptide containing 581 amino acids and having a molecular mass of 61 kDa but as a result of glycosylation, migrates at 75-85 kDa under reducing condit

Please view FAQs here