Endoglin Human Recombinant Protein

Item Information
Catalog #
Specification
AliasesCD105, ENG, END, ORW, HHT1, ORW1, FLJ41744, Endoglin.
Product OrderE
FormulationEndoglin was lyophilized from a concentrated (1mg/ml) sterile solution containing 1xPBS.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityHuman
Sequence
MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTY\ \ TTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVL\ \ SVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPI\ \ TSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLE\ \ GVAGHKEAHILRVLPGHSAGPRTVTVKVE
Catalog
Pr20581
$50.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description CD105 Human Recombinant extracellular domain produced in baculovirus is a homodimeric, glycosylated, Polypeptide containing 586 amino acids and having a molecular mass of 61 kDa but as a result of glycosylation, migrates at 90 kDa under reducing condition

Please view FAQs here