BAFF R Human Recombinant Protein

Item Information
Catalog #
Specification
AliasesTNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.
Product OrderB
FormulationLyophilized from a 0.2μM filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityHuman
Sequence
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.
Catalog
Pr20162
$50.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.The BAFF-R is purified by proprietary technologyary technonlogyary chromatographi

Please view FAQs here