IL 8 Rabbit Recombinant Protein

Item Information
Catalog #
Specification
AliasesIL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, Emoctaki
Product OrderI
FormulationThe IL-8 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityRabbit
Sequence
AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVVQIFLKRAEQQES
Catalog
Pr21323
$50.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description IL-8 Rabbit Recombinant is a full length secreted protein (79 amino acids - a.a. 23-101). The IL-8 is expressed in E.Coli. and fused to a N-terminal His tag, having a total MW of 12.24kDa.

Please view FAQs here