TFPI2 Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesTFPI-2, REF1,Placental protein 52.
ProductOrderT
FormulationLyophilized from a concentrated (1mg/ml) solution containing PBS pH-7.1.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV.
Catalog#: Pr22296
Inquire
Contact us to order
Images
TFPI2 Human Recombinant Protein
TFPI2 Human Recombinant Protein
Product Overview
Description

TFPI2 Human Recombinant produced in plants is a single polypeptide chain containing 79 amino acids and having a total molecular mass of 9.3kDa. The TFPI2 is fused to 6xHis Tag at N-terminus and purified by proprietary technologyary technonlogyary chromatographic techniques.