GMFB Human Recombinant Protein
| Item Information | ||
|---|---|---|
| Catalog # | Size/Concentration | Price |
| Specification | |
|---|---|
| Aliases | Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF. |
| ProductOrder | G |
| Formulation | The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl. |
| Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
| Species Reactivity | Human |
| Sequence | |
|---|---|
| SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH. | |