GMFB Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesGlia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF.
ProductOrderG
FormulationThe GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH.
Catalog#: Pr20825
Inquire
Contact us to order
Images
GMFB Human Recombinant Protein
GMFB Human Recombinant Protein
Product Overview
Description

Glia Maturation Factor-Beta (GMF-Beta) Human Recombinant produced in E.Coli is a signle, non-glycosylated, polypeptide chain containing 141 amino acids and having a total molecular mass of 16.5 kDa. Glia Maturation Factor-Beta, GMF-Beta, Human Recom