FSH Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesFollitropin subunit beta, Follicle-stimulating hormone beta subunit, FSH-beta, FSH-B, Follitropin beta chain, FSH.
ProductOrderF
FormulationThe recombinant FSH was lyophilized from a concentrated (1mg/ml) solution containing PBS.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS. FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYC
Catalog#: Pr20717
Inquire
Contact us to order
Images
FSH Human Recombinant Protein
FSH Human Recombinant Protein
Product Overview
Description

FSH Human Recombinant produced in HEK-293 cells is heterodimeric, glycosylated, polypeptide chain transfected with two expression plasmids encoding the human FSH-alpha chain (Accession # P01215) (Met1-Ser116) and human FSH-beta chain(Accession # P01225) (