GNLY Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesLAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E.
ProductOrderG
FormulationThe Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH
Catalog#: Pr20830
Inquire
Contact us to order
Images
GNLY Human Recombinant Protein
GNLY Human Recombinant Protein
Product Overview
Description

GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa.The GNLY is purified by proprietary technologyary technonlogyary chr