IL 13 Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesNC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.
ProductOrderI
FormulationThe protein (1mg/ml) was lyophilized with 1X PBS pH-7.2.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.
Catalog#: Pr21237
Inquire
Contact us to order
Images
IL 13 Human Recombinant Protein
IL 13 Human Recombinant Protein
Product Overview
Description

Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary technologyary technonlogyary chromatographic techniques.