EBI3 Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesInterleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27B.
ProductOrderE
FormulationEBI3 Human Recombinant was lyophilized from a solution containig 10mM Acetic Acid and 0.5% Mannitol.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK.
Catalog#: Pr20532
Inquire
Contact us to order
Images
EBI3 Human Recombinant Protein
EBI3 Human Recombinant Protein
Product Overview
Description

EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa. The EBI3 is purified by proprietary technologyary technonlogyary chromatographic techniques.