BMP 7 Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesOsteogenic Protein 1, BMP-7.
ProductOrderB
FormulationBMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.
Catalog#: Pr20216
Inquire
Contact us to order
Images
BMP 7 Human Recombinant Protein
BMP 7 Human Recombinant Protein
Product Overview
Description

Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by