Acrp30 Human Recombinant Protein

Item Information
Catalog #Size/ConcentrationPrice
Specification
AliasesAcrp30, AdipoQ, GBP-28, APM-1, ACDC.
ProductOrderA
FormulationAcrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1 mM DTT.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species ReactivityHuman
Sequence
MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Catalog#: Pr20017
Inquire
Contact us to order
Images
Acrp30 Human Recombinant Protein
Acrp30 Human Recombinant Protein
Product Overview
Description

The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244).