Sign up for news & promotions:
DPP4 Human Recombinant Protein
| Item Information | ||
|---|---|---|
| Catalog # | ||
| Pr20519 | ||
| Specification | |
|---|---|
| Aliases | CD26, ADABP, ADCP2, DPPIV, TP103, DPP4, Dipeptidyl peptidase 4, Dipeptidyl peptidase IV, DPP IV, T-cell activation antigen CD26, Adenosine deaminase complexing protein 2, CD26 antigen. |
| Product Order | D |
| Formulation | DPP4 is formulated in 20mM Tris-HCl buffer pH-8, 100mM NaCl, 1mM EDTA and 10% glycerol. |
| Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
| Species Reactivity | Human |
| Sequence |
|---|
| ADP-SRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKA |
Images
Product Overview
| Description | DPPIV Human Recombinant produced in High-5 cells is a single, glycosylated polypeptide chain containing 746 amino acids (39-766) and having a molecular mass of 86.4 kDa.DPPIV is fused to His Tag at C-terminus and purified using conventional chromato |
|---|