Sign up for news & promotions:
DPP4 Human Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | ||
Pr20519 |
Specification | |
---|---|
Aliases | CD26, ADABP, ADCP2, DPPIV, TP103, DPP4, Dipeptidyl peptidase 4, Dipeptidyl peptidase IV, DPP IV, T-cell activation antigen CD26, Adenosine deaminase complexing protein 2, CD26 antigen. |
Product Order | D |
Formulation | DPP4 is formulated in 20mM Tris-HCl buffer pH-8, 100mM NaCl, 1mM EDTA and 10% glycerol. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Human |
Sequence |
---|
ADP-SRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKA |
Images

Product Overview
Description | DPPIV Human Recombinant produced in High-5 cells is a single, glycosylated polypeptide chain containing 746 amino acids (39-766) and having a molecular mass of 86.4 kDa.DPPIV is fused to His Tag at C-terminus and purified using conventional chromato |
---|