Sign up for news & promotions:
IFN b Mouse Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | ||
Pr21191 |
Specification | |
---|---|
Aliases | Leukocyte interferon, B cell interferon, Type I interferon, IFNB1, IFB, IFF, IFNB, IFN-b 1b, MGC96956. |
Product Order | I |
Formulation | IFN-b Mouse solution containing 10mM sodium phosphate pH-7.5 and 0.5M ammonium sulfate. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Mouse |
Sequence |
---|
MINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN. |
Images

Product Overview
Description | Interferon beta Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 162 amino acids and having a molecular mass of 19.8 kDa.Mouse IFN beta is purified by proprietary technologyary technonlogyary chromatographic techniques. |
---|