BNP Human Recombinant Protein

Item Information
Catalog #

Specification
Aliases	NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
Product Order	B
Formulation	Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.
Shipping Information	This product will ship in a box containing blue ice at a temperature of 4°C. Learn More
Species Reactivity	Human

Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Images

Product Overview

Description	B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary technologyary technonlogyary chromatographic techniques.