BNP Human Recombinant Protein

Item Information
Catalog #
Specification
AliasesNPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
Product OrderB
FormulationNatriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.
Shipping InformationThis product will ship in a box containing blue ice at a temperature of 4°C.  Learn More
Species ReactivityHuman
Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Catalog
Pr20220
$50.00

Contact us to order

Images

Cell Culture Products
Product Overview
Description B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary technologyary technonlogyary chromatographic techniques.

Please view FAQs here