Sign up for news & promotions:
BNP Human Recombinant Protein
| Item Information | ||
|---|---|---|
| Catalog # | ||
| Pr20220 | ||
| Specification | |
|---|---|
| Aliases | NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide. |
| Product Order | B |
| Formulation | Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride. |
| Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
| Species Reactivity | Human |
| Sequence |
|---|
| SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH. |
Images
Product Overview
| Description | B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary technologyary technonlogyary chromatographic techniques. |
|---|