Sign up for news & promotions:
BNP Human Recombinant Protein
Item Information | ||
---|---|---|
Catalog # | ||
Pr20220 |
Specification | |
---|---|
Aliases | NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide. |
Product Order | B |
Formulation | Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride. |
Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
Species Reactivity | Human |
Sequence |
---|
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH. |
Images

Product Overview
Description | B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary technologyary technonlogyary chromatographic techniques. |
---|