HBsAg preS2 Recombinant Protein
| Item Information | ||
|---|---|---|
| Catalog # | Size/Concentration | Price |
| Specification | |
|---|---|
| ProductOrder | H |
| Formulation | HBsAg protein was lyophilized from 0.2μM filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl. |
| Shipping Information | This product will ship in a box containing blue ice at a temperature of 4°C. Learn More |
| Species Reactivity | Virus |
| Sequence | |
|---|---|
| MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN. | |